TCRT5 model (pre-trained)
Model description
This model is the pre-trained model used for finetuning TCRT5. The finetuned model is a seq2seq model designed for the conditional generation of T-cell receptor (TCR) sequences given a target peptide-MHC (pMHC). It is a transformers model that is built on the T5 architecture and operationalized by the associated HuggingFace abstraction. It is released along with this paper).
Intended uses & limitations
This model is released to be used for seq2seq finetuning on custom datasets. It may be useful for both the pMHC -> TCR (TCR design) or TCR -> pMHC (TCR de-orphanization) sequence generation. Additionally, it can also be used (though it has not been tested in this capacity) for finetuning on classification or regression-style tasks involving sequence representations of TCR (CDR3 ) and pMHC (peptide-pseudo sequence):
How to use
from transformers import T5Tokenizer, T5ForConditionalGeneration
tokenizer = T5Tokenizer.from_pretrained('dkarthikeyan1/tcrt5_pre_tcrdb')
tcrt5 = T5ForConditionalGeneration.from_pretrained("dkarthikeyan1/tcrt5_pre_tcrdb")
pmhc = "[PMHC]KLGGALQAK[SEP]YFAMYQENVAQTDVDTLYIIYRDYTWAELAYTWY[EOS]"
encoded_pmhc = tokenizer(pmhc, return_tensors='pt')
# Can be useful for classification/regression downstream tasks
enc_outputs = tcrt5.encoder(**encoded_pmhc)
Limitations
As it stands, the model was jointly pre-trained on peptide-pseudosequence and CDR3 sequences. As such sequences comprised of just peptide, CDR3 , or other parts of the TCR would be out-of-distribution OOD.
Training data
TCRT5 was pre-trained on masked span reconstruction of on a dataset built around ~14M CDR3 sequences from TCRdb as well as ~780k peptide-pseudosequence pairs taken from IEDB. To correct for the data imbalance, upsampling was used to bring the TCR:pMHC sequence ratio to 70:30.
Training procedure
Preprocessing
All amino acid sequences, and V/J gene names were standardized using the tidytcells package. See here. MHC
allele information was standardized using mhcgnomes, available here before mapping allele information to the MHC pseudo-sequence
as defined in NetMHCpan.
Pre-training
TCRT5 was pretrained with Masked language modeling (MLM): Span reconstruction similar to the original training loss of the T5 paper. For a given sequence, the model masks 15% of the sequence using contiguous spans of random length from length 1-3. This is done via the sentinel tokens introduced in the T5 paper. Then the entire masked sequence is passed into the model and the model is trained to reconstruct a concatenated sequence comprised of the sentinel tokens followed by the masked tokens. This forces the model to learn richer k-mer dependencies of the masked sequences.
Masks 'mlm_probability' tokens grouped into spans of size 'max_span_length' according to the following algorithm:
* Radnomly generate span lengths that add up to round(mlm_probability*seq_len) (ignoring pad token) for each sequence.
* Ensure that the spans are not directly adjacent to ensure max_span_length is observed
* Once the span masks are generated according to T5 standards mask the inputs and generate the targets
Example Input:
CASSLGQGYEQYF
Masked Input:
CASSLG[X]GY[Y]F
Target:
[X]Q[Y]EQY[Z].
Hyperparameters:
| Hparam | #Enc. | #Dec. | Vocab. Size | D_model | Num Attn. Heads | Dropout | D_ff |
|---|---|---|---|---|---|---|---|
| 10 | 10 | 128 | 256 | 16 | 0.1 | 1024 |
| TA | Bsz. | LR | Steps | Weight Decay | Warmup |
|---|---|---|---|---|---|
| 512 | 3e- 4 | 168k (~4eps) | 0.1 | 500 |
Hardware
- Hardware Type: NVIDIA A100 80GB PCIe
- Hours used: 60
- Carbon Emitted: 6.48 kg CO2 eq.
Carbon emissions were estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
BibTeX entry and citation info
@Article{Karthikeyan2025_tcrtranslate,
author={Karthikeyan, Dhuvarakesh
and Bennett, Sarah N.
and Reynolds, Amy G.
and Vincent, Benjamin G.
and Rubinsteyn, Alex},
title={Conditional generation of real antigen-specific T cell receptor sequences},
journal={Nature Machine Intelligence},
year={2025},
month={Sep},
day={08},
abstract={Despite recent advances in T cell receptor (TCR) engineering, designing functional TCRs against arbitrary targets remains challenging due to complex rules governing cross-reactivity and limited paired data. Here we present TCR-TRANSLATE, a sequence-to-sequence framework that adapts low-resource machine translation techniques to generate antigen-specific TCR sequences against unseen epitopes. By evaluating 12 model variants of the BART and T5 model architectures, we identified key factors affecting performance and utility, revealing discordances between these objectives. Our flagship model, TCRT5, outperforms existing approaches on computational benchmarks, prioritizing functionally relevant sequences at higher ranks. Most significantly, we experimentally validated a computationally designed TCR against Wilms' tumour antigen, a therapeutically relevant target in leukaemia, excluded from our training and validation sets. Although the identified TCR shows cross-reactivity with pathogen-derived peptides, highlighting limitations in specificity, our work represents the successful computational design of a functional TCR construct against a non-viral epitope from the target sequence alone. Our findings establish a foundation for computational TCR design and reveal current limitations in data availability and methodology, providing a framework for accelerating personalized immunotherapy by reducing the search space for novel targets.},
issn={2522-5839},
doi={10.1038/s42256-025-01096-6},
url={https://doi.org/10.1038/s42256-025-01096-6}
}
- Downloads last month
- 1,206